Motif identified by HMMER search
Type:  KRAB-A
Genomic coordinates:  chr7:148252962-148253085
Genomic Sequence:  (123 bases)
actgtgacatttgatgatgtggccttatatttttcggaa
caagagtgggagatcctggagaagtggcagaagcaaatg
tataagcaagagatgaagaccaattacgagacccttgat
tccctg
Translated Genomic Sequence:  (41 residues)
TVTFDDVALYFSEQEWEILEKWQKQMYKQEMKTNYETLD
SL
Stop codon count:  0
HMMER E-value  :  2.1E-18
HMMER bit score  :  58.7