Motif identified by HMMER search
Type:  KRAB-A
Genomic coordinates:  chr19:57073454-57073577
Genomic Sequence:  (123 bases)
tcattgtcattcgaagatgtggctgtgggcttcaccagg
gaggagtggcagtttttggaccagtctcagaaggtcttg
tacaaggaagtaatgttggagaactacatcaacctagta
tcaata
Translated Genomic Sequence:  (41 residues)
SLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYINLV
SI
Stop codon count:  0
HMMER E-value  :  8.1E-26
HMMER bit score  :  83.4