Motif identified by HMMER search
Type:  Finger
Genomic coordinates:  chr7:98816097-98816187
Genomic Sequence:  (90 bases)
tacaaatgtattgaatgtggcaaatttttcatgctatta
gtattttcataccttagtcacatttggagaattcacatg
ggaataaaattc
Translated Genomic Sequence:  (30 residues; this is a NON-canonical finger sequence)
YKCIECGKFFMLLVFSYLSHIWRIHMGIKF
Stop codon count:  0
HMMER E-value  :  2.0E-5
HMMER bit score  :  8.7