Motif identified by HMMER search
Type:  KRAB-B
Genomic coordinates:  chr16:31642081-31642174
Genomic Sequence:  (93 bases)
ctcgctgtctctaagccggacctgatcacctttttggag
caaaggaaagagccctggaatgtgaagagtgcagagaca
gtagccatccagcca
Translated Genomic Sequence:  (31 residues)
LAVSKPDLITFLEQRKEPWNVKSAETVAIQP
Stop codon count:  0
HMMER E-value  :  1.9E-19
HMMER bit score  :  62.2