Motif identified by HMMER search
Type:  KRAB-A
Genomic coordinates:  chr16:31641450-31641573
Genomic Sequence:  (123 bases)
ctgttgacattcagggatgtggccatagaattctctcgg
gaggagtgggaacacctggactcagatcagaagctttta
tatggggatgtgatgttagagaactacggaaacctggtc
tctctg
Translated Genomic Sequence:  (41 residues)
LLTFRDVAIEFSREEWEHLDSDQKLLYGDVMLENYGNLV
SL
Stop codon count:  0
HMMER E-value  :  3.1E-27
HMMER bit score  :  88.0